firstStage   2  
lastStage    2  

reportingInterval 1.0
numReportingIntervals  15

temperature 1.0  
removeRigidBodyMomentum false

# beetle TERT template:
protein E 94                                                                                 CYDYDAIPWLQNVEPNLRPKLLLKHNLFLLDNIVKPIIAFYYKPIKTLNGHEIKFIRKEEYIS 

#  threaded human TERT fragment sequence
protein H 522                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            RSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSV 


# providing no residue numbers rigidifies the entire chain E:
mobilizer Rigid E   

# It should be obvious what "FirstResidue" means
constrainToGround E FirstResidue

threading H 	524	543	E	96	115 300 
threading H 	544	580	E	117	153 300 


#excludedVolumeRadius   .9 

# we apply contacts to chain H only.  applying them to chain E would lead to no threading! 
contact  AllAtomSterics H  FirstResidue LastResidue