firstStage 2 lastStage 3 readAtStage 2 # Template, 1WDN loadSequencesFromPdb 1WDN.short.pdb # Old way, one could specify the sequence explicitly: #protein B 4 KLVVATDTAFVPFEFKQGDLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTEPKQ # Model, 1GGG loadSequencesFromPdb 1GGG.short.pdb # Old way, one could specify the sequence explicitly: #protein A 5 LVVATDTAFVPFEFKQGDLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE readBlockEnd readAtStage 3 loadSequencesFromPdb readBlockEnd alignmentForces noGap alignmentForces A 5 224 B 5 224 #threading A 5 224 B 5 224 # you will want to reduce this if you remove the mobilizer .. Rigid commands. removeRigidBodyMomentum false temperature 1.0 # make all chains (A and B) Rigid along their full lengths: mobilizer Rigid # Rigid alignment stage readAtStage 2 deactivatePhysics A deactivatePhysics B # This stage is short, will converge after 60 ps or so: reportingInterval 10.0 numReportingIntervals 6 # Do nothing. All chains will be left fully rigid. #mobilizer Rigid A 5 224 readBlockEnd readAtStage 3 reportingInterval 1.0 numReportingIntervals 25 # Flexibilize just the hinges on your model: mobilizer Default A 87+1 90-1 mobilizer Default A 180+1 184-1 # The N- and C-termini are in the same, discontinuous domain. Constrain them to each other, otherwise the domain would fall apart: constraint A FirstResidue Weld A LastResidue setDefaultMDParameters physicsRadius .7 # Turn off physics for the template chain: deactivatePhysics B #mobilizer Rigid A 5 87 #mobilizer Rigid A 90 180 #mobilizer Rigid A 184 224 #constrainToGround A 5 #constrainToGround A 195 readBlockEnd